| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies) beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha |
Superfamily d.100.1: L9 N-domain-like [55658] (2 families) ![]() |
| Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein) |
| Protein Ribosomal protein L9 N-domain [55660] (3 species) |
| Species Bacillus stearothermophilus [TaxId:1422] [55661] (9 PDB entries) |
| Domain d2hvfa1: 2hvf A:1-52 [147419] complexed with acy, cl, imd, zn; mutant |
PDB Entry: 2hvf (more details), 1.57 Å
SCOP Domain Sequences for d2hvfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hvfa1 d.100.1.1 (A:1-52) Ribosomal protein L9 N-domain {Bacillus stearothermophilus [TaxId: 1422]}
mkviflkdvkgkgkkgeiknvadgyannflfkqalaieatpanlkaleaqkq
Timeline for d2hvfa1: