Lineage for d2hvfa1 (2hvf A:1-52)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 869343Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 869344Superfamily d.100.1: L9 N-domain-like [55658] (2 families) (S)
  5. 869345Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
  6. 869346Protein Ribosomal protein L9 N-domain [55660] (3 species)
  7. 869347Species Bacillus stearothermophilus [TaxId:1422] [55661] (9 PDB entries)
  8. 869350Domain d2hvfa1: 2hvf A:1-52 [147419]
    complexed with acy, cl, imd, zn; mutant

Details for d2hvfa1

PDB Entry: 2hvf (more details), 1.57 Å

PDB Description: crystal structure of n-terminal domain of ribosomal protein l9 (ntl9), g34da
PDB Compounds: (A:) 50S ribosomal protein L9

SCOP Domain Sequences for d2hvfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hvfa1 d.100.1.1 (A:1-52) Ribosomal protein L9 N-domain {Bacillus stearothermophilus [TaxId: 1422]}
mkviflkdvkgkgkkgeiknvadgyannflfkqalaieatpanlkaleaqkq

SCOP Domain Coordinates for d2hvfa1:

Click to download the PDB-style file with coordinates for d2hvfa1.
(The format of our PDB-style files is described here.)

Timeline for d2hvfa1: