| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.106: SCP-like [55717] (1 superfamily) alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145 |
Superfamily d.106.1: SCP-like [55718] (5 families) ![]() |
| Family d.106.1.4: EF1021 C-terminal domain-like [160620] (3 proteins) |
| Protein Hypothetical protein EF1021 [160621] (1 species) |
| Species Enterococcus faecalis [TaxId:1351] [160622] (1 PDB entry) Uniprot Q836T6 287-397 |
| Domain d2hv2e1: 2hv2 E:287-397 [147414] Other proteins in same PDB: d2hv2a2, d2hv2b2, d2hv2c2, d2hv2d2, d2hv2e2, d2hv2f2 automatically matched to 2HV2 A:287-397 complexed with epe, pg4 |
PDB Entry: 2hv2 (more details), 2.4 Å
SCOPe Domain Sequences for d2hv2e1:
Sequence, based on SEQRES records: (download)
>d2hv2e1 d.106.1.4 (E:287-397) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]}
elqtflekypfqsgeketysleiedsygpwnegiwtitideqgkatvtkgaaekegtaal
kadiqtwtqlflgyrsaetlsfyerlqgdatiaqrlgqrlvkgmpiledyf
>d2hv2e1 d.106.1.4 (E:287-397) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]}
elqtflekypfqsgeketysleiedsygpwnegiwtitideqgkatvtkgaaalkadiqt
wtqlflgyrsaetlsfyerlqgdatiaqrlgqrlvkgmpiledyf
Timeline for d2hv2e1: