Class b: All beta proteins [48724] (176 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.5: Smr-associated domain-like [158949] (1 family) automatically mapped to Pfam PF09640 |
Family b.7.5.1: Smr-associated domain [158950] (1 protein) Pfam PF09640; DUF2027 |
Protein Putative DNA mismatch repair protein BT2179 [158951] (1 species) |
Species Bacteroides thetaiotaomicron [TaxId:818] [158952] (1 PDB entry) Uniprot Q8A5Q9 81-227 |
Domain d2huha1: 2huh A:81-227 [147405] complexed with mg |
PDB Entry: 2huh (more details), 1.54 Å
SCOPe Domain Sequences for d2huha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2huha1 b.7.5.1 (A:81-227) Putative DNA mismatch repair protein BT2179 {Bacteroides thetaiotaomicron [TaxId: 818]} rqpevrggdtlnvflayvpedakammttpfeaylvndsnyylyytylsaegkawnnrshg lvepntkllleeftkdvlnemervavqliafkdgkpaaikpavsvelridtvkfyklhtf sasdffeepaliydivkddvpakqvyv
Timeline for d2huha1: