Lineage for d2huha1 (2huh A:81-227)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1775883Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1776283Superfamily b.7.5: Smr-associated domain-like [158949] (1 family) (S)
    automatically mapped to Pfam PF09640
  5. 1776284Family b.7.5.1: Smr-associated domain [158950] (1 protein)
    Pfam PF09640; DUF2027
  6. 1776285Protein Putative DNA mismatch repair protein BT2179 [158951] (1 species)
  7. 1776286Species Bacteroides thetaiotaomicron [TaxId:818] [158952] (1 PDB entry)
    Uniprot Q8A5Q9 81-227
  8. 1776287Domain d2huha1: 2huh A:81-227 [147405]
    complexed with mg

Details for d2huha1

PDB Entry: 2huh (more details), 1.54 Å

PDB Description: crystal structure of a duf2027 family protein (bt_2179) from bacteroides thetaiotaomicron at 1.54 a resolution
PDB Compounds: (A:) Putative DNA mismatch repair protein

SCOPe Domain Sequences for d2huha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2huha1 b.7.5.1 (A:81-227) Putative DNA mismatch repair protein BT2179 {Bacteroides thetaiotaomicron [TaxId: 818]}
rqpevrggdtlnvflayvpedakammttpfeaylvndsnyylyytylsaegkawnnrshg
lvepntkllleeftkdvlnemervavqliafkdgkpaaikpavsvelridtvkfyklhtf
sasdffeepaliydivkddvpakqvyv

SCOPe Domain Coordinates for d2huha1:

Click to download the PDB-style file with coordinates for d2huha1.
(The format of our PDB-style files is described here.)

Timeline for d2huha1: