Lineage for d2huga1 (2hug A:3-57)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1311416Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 1311452Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 1311489Protein CpSRP43 [141216] (1 species)
    Signal recognition particle 43 kDa protein, chloroplast precursor (CAO)
  7. 1311490Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141217] (6 PDB entries)
    Uniprot O22265 265-319! Uniprot O22265 320-373! Uniprot O22265 84-128
  8. 1311493Domain d2huga1: 2hug A:3-57 [147404]
    automatically matched to d1x3qa1

Details for d2huga1

PDB Entry: 2hug (more details)

PDB Description: 3d solution structure of the chromo-2 domain of cpsrp43 complexed with cpsrp54 peptide
PDB Compounds: (A:) Signal recognition particle 43 kDa protein, chloroplast

SCOPe Domain Sequences for d2huga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2huga1 b.34.13.2 (A:3-57) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qvfeyaevdeivekrgkgkdveylvrwkdggdcewvkgvhvaedvakdyedgley

SCOPe Domain Coordinates for d2huga1:

Click to download the PDB-style file with coordinates for d2huga1.
(The format of our PDB-style files is described here.)

Timeline for d2huga1: