![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.13: Chromo domain-like [54160] (3 families) ![]() SH3-like barrel is capped by a C-terminal helix |
![]() | Family b.34.13.2: Chromo domain [54165] (7 proteins) lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold |
![]() | Protein CpSRP43 [141216] (1 species) Signal recognition particle 43 kDa protein, chloroplast precursor (CAO) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141217] (6 PDB entries) Uniprot O22265 265-319! Uniprot O22265 320-373! Uniprot O22265 84-128 |
![]() | Domain d2huga1: 2hug A:3-57 [147404] automatically matched to d1x3qa1 |
PDB Entry: 2hug (more details)
SCOP Domain Sequences for d2huga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2huga1 b.34.13.2 (A:3-57) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} qvfeyaevdeivekrgkgkdveylvrwkdggdcewvkgvhvaedvakdyedgley
Timeline for d2huga1: