SCOPe 2.08: Domain d2huga2: 2hug A:3-57

Lineage for d2huga2 (2hug A:3-57)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein CpSRP43 [141216] (1 species)
   Signal recognition particle 43 kDa protein, chloroplast precursor (CAO)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141217] (6 PDB entries)
   Uniprot O22265 265-319! Uniprot O22265 320-373! Uniprot O22265 84-128

8. Domain d2huga2: 2hug A:3-57 [147404]
   Other proteins in same PDB: d2huga3
   automated match to d2huga1

Details for d2huga2

PDB Entry: 2hug

PDB Description: 3d solution structure of the chromo-2 domain of cpsrp43 complexed with cpsrp54 peptide

PDB Compounds: (A:) Signal recognition particle 43 kDa protein, chloroplast

SCOPe Domain Sequences for d2huga2:

Sequence; same for both SEQRES and ATOM records:

>d2huga2 b.34.13.2 (A:3-57) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qvfeyaevdeivekrgkgkdveylvrwkdggdcewvkgvhvaedvakdyedgley

Timeline for d2huga2:

• d2huga2 first appeared in SCOP 1.75, called d2huga1
  
• d2huga2 appears in SCOPe 2.07