Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) SH3-like barrel is capped by a C-terminal helix |
Family b.34.13.2: Chromo domain [54165] (8 proteins) lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold |
Protein CpSRP43 [141216] (1 species) Signal recognition particle 43 kDa protein, chloroplast precursor (CAO) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141217] (6 PDB entries) Uniprot O22265 265-319! Uniprot O22265 320-373! Uniprot O22265 84-128 |
Domain d2huga2: 2hug A:3-57 [147404] Other proteins in same PDB: d2huga3 automated match to d2huga1 |
PDB Entry: 2hug (more details)
SCOPe Domain Sequences for d2huga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2huga2 b.34.13.2 (A:3-57) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} qvfeyaevdeivekrgkgkdveylvrwkdggdcewvkgvhvaedvakdyedgley
Timeline for d2huga2: