Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.3: MoaD/ThiS [54285] (5 families) possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies |
Family d.15.3.2: ThiS [54289] (5 proteins) |
Protein Uncharacterised protein TTHA0675 [159929] (1 species) probable ThiS homologue |
Species Thermus thermophilus [TaxId:274] [159930] (2 PDB entries) Uniprot Q5SKG8 1-63 |
Domain d2htmh_: 2htm H: [147401] Other proteins in same PDB: d2htma_, d2htmb_, d2htmc_, d2htmd_ automated match to d2cu3a1 |
PDB Entry: 2htm (more details), 2.3 Å
SCOPe Domain Sequences for d2htmh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2htmh_ d.15.3.2 (H:) Uncharacterised protein TTHA0675 {Thermus thermophilus [TaxId: 274]} mvwlngeprplegktlkevleemgvelkgvavllneeaflglevpdrplrdgdvvevval mqgg
Timeline for d2htmh_: