SCOPe 2.07: Domain d2htme_: 2htm E:

Lineage for d2htme_ (2htm E:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.3: MoaD/ThiS [54285] (5 families)
   possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.3.2: ThiS [54289] (5 proteins)

6. Protein Uncharacterised protein TTHA0675 [159929] (1 species)
   probable ThiS homologue

7. Species Thermus thermophilus [TaxId:274] [159930] (2 PDB entries)
   Uniprot Q5SKG8 1-63

8. Domain d2htme_: 2htm E: [147398]
   Other proteins in same PDB: d2htma_, d2htmb_, d2htmc_, d2htmd_
   automated match to d2cu3a1

Details for d2htme_

PDB Entry: 2htm, 2.3 Å

PDB Description: Crystal structure of TTHA0676 from Thermus thermophilus HB8

PDB Compounds: (E:) Putative thiamine biosynthesis protein ThiS

SCOPe Domain Sequences for d2htme_:

Sequence; same for both SEQRES and ATOM records:

>d2htme_ d.15.3.2 (E:) Uncharacterised protein TTHA0675 {Thermus thermophilus [TaxId: 274]}
mvwlngeprplegktlkevleemgvelkgvavllneeaflglevpdrplrdgdvvevval
mqgg

Timeline for d2htme_:

• d2htme_ first appeared in SCOP 1.75, called d2htme1
  
• d2htme_ appears in SCOPe 2.06
  
• d2htme_ appears in the current release, SCOPe 2.08