SCOPe 2.08: Domain d2htja1: 2htj A:1-73

Lineage for d2htja1 (2htj A:1-73)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.73: FaeA-like [158305] (1 protein)
   Pfam PF04703

6. Protein P fimbrial regulatory protein PapI [158306] (1 species)
   KS71A

7. Species Escherichia coli [TaxId:562] [158307] (1 PDB entry)
   Uniprot P62584 5-77

8. Domain d2htja1: 2htj A:1-73 [147397]
   Other proteins in same PDB: d2htja2

Details for d2htja1

PDB Entry: 2htj

PDB Description: nmr structure of e.coli papi

PDB Compounds: (A:) P fimbrial regulatory protein KS71A

SCOPe Domain Sequences for d2htja1:

Sequence; same for both SEQRES and ATOM records:

>d2htja1 a.4.5.73 (A:1-73) P fimbrial regulatory protein PapI {Escherichia coli [TaxId: 562]}
mkneileflnrhnggktaeiaealavtdyqaryyllllekagmvqrsplrrgmatywflk
gekqagqscsstt

Timeline for d2htja1:

• d2htja1 first appeared in SCOP 1.75
  
• d2htja1 appears in SCOPe 2.07