Lineage for d2hsxa_ (2hsx A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011338Fold d.346: SARS Nsp1-like [160098] (1 superfamily)
    complex alpha+beta fold; contains mixed beta-sheet barrel, n=6, S=10
  4. 3011339Superfamily d.346.1: SARS Nsp1-like [160099] (1 family) (S)
    automatically mapped to Pfam PF11501
  5. 3011340Family d.346.1.1: SARS Nsp1-like [160100] (2 proteins)
  6. 3011341Protein Nsp1 [160101] (1 species)
  7. 3011342Species SARS coronavirus [TaxId:227859] [160102] (2 PDB entries)
    Uniprot P59641 13-127
  8. 3011344Domain d2hsxa_: 2hsx A: [147396]
    automated match to d2hsxa1

Details for d2hsxa_

PDB Entry: 2hsx (more details)

PDB Description: nmr structure of the nonstructural protein 1 (nsp1) from the sars coronavirus
PDB Compounds: (A:) Leader protein; p65 homolog; NSP1 (EC 3.4.22.-)

SCOPe Domain Sequences for d2hsxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hsxa_ d.346.1.1 (A:) Nsp1 {SARS coronavirus [TaxId: 227859]}
ghvqlslpvlqvrdvlvrgfgdsveealsearehlkngtcglvelekgvlpqleqpyvfi
krsdalstnhghkvvelvaemdgiqygrsgitlgvlvphvgetpiayrnvllrkng

SCOPe Domain Coordinates for d2hsxa_:

Click to download the PDB-style file with coordinates for d2hsxa_.
(The format of our PDB-style files is described here.)

Timeline for d2hsxa_: