SCOPe 2.08: Domain d2hsta_: 2hst A:

Lineage for d2hsta_ (2hst A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (3 families)

5. Family c.55.4.2: ERF1/Dom34 middle domain-like [53143] (3 proteins)
   automatically mapped to Pfam PF03464

6. Protein Middle domain of eukaryotic peptide chain release factor subunit 1, ERF1 [53144] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53145] (2 PDB entries)

8. Domain d2hsta_: 2hst A: [147395]
   automated match to d2hsta1

Details for d2hsta_

PDB Entry: 2hst

PDB Description: solution structure of the middle domain of human eukaryotic translation termination factor erf1

PDB Compounds: (A:) Eukaryotic peptide chain release factor subunit 1

SCOPe Domain Sequences for d2hsta_:

Sequence; same for both SEQRES and ATOM records:

>d2hsta_ c.55.4.2 (A:) Middle domain of eukaryotic peptide chain release factor subunit 1, ERF1 {Human (Homo sapiens) [TaxId: 9606]}
lsddskfgfividgsgalfgtlqgntrevlhkftvdlpkkhgrggqsalrfarlrmekrh
nyvrkvaetavqlfisgdkvnvaglvlagsadfktelsqsdmfdqrlqskvlklvdisyg
gengfnqaielstevl

Timeline for d2hsta_:

• d2hsta_ first appeared in SCOP 1.75, called d2hsta1
  
• d2hsta_ appears in SCOPe 2.07