Lineage for d2hsta_ (2hst A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2125117Superfamily c.55.4: Translational machinery components [53137] (3 families) (S)
  5. 2125281Family c.55.4.2: ERF1/Dom34 middle domain-like [53143] (3 protein domains)
    automatically mapped to Pfam PF03464
  6. 2125290Protein Middle domain of eukaryotic peptide chain release factor subunit 1, ERF1 [53144] (1 species)
  7. 2125291Species Human (Homo sapiens) [TaxId:9606] [53145] (2 PDB entries)
  8. 2125293Domain d2hsta_: 2hst A: [147395]
    automated match to d2hsta1

Details for d2hsta_

PDB Entry: 2hst (more details)

PDB Description: Solution structure of the middle domain of human eukaryotic translation termination factor eRF1
PDB Compounds: (A:) Eukaryotic peptide chain release factor subunit 1

SCOPe Domain Sequences for d2hsta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hsta_ c.55.4.2 (A:) Middle domain of eukaryotic peptide chain release factor subunit 1, ERF1 {Human (Homo sapiens) [TaxId: 9606]}
lsddskfgfividgsgalfgtlqgntrevlhkftvdlpkkhgrggqsalrfarlrmekrh
nyvrkvaetavqlfisgdkvnvaglvlagsadfktelsqsdmfdqrlqskvlklvdisyg
gengfnqaielstevl

SCOPe Domain Coordinates for d2hsta_:

Click to download the PDB-style file with coordinates for d2hsta_.
(The format of our PDB-style files is described here.)

Timeline for d2hsta_: