SCOPe 2.03: Domain d2hsmb1: 2hsm B:4-121

Lineage for d2hsmb1 (2hsm B:4-121)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.2: Arc1p N-terminal domain-like [158491] (1 protein)
   PfamB PB021108

6. Protein GU4 nucleic-binding protein 1, Arc1p [158492] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [158493] (4 PDB entries)
   Uniprot P46672 4-121

8. Domain d2hsmb1: 2hsm B:4-121 [147393]
   automatically matched to 2HQT A:4-121
   protein/RNA complex

Details for d2hsmb1

PDB Entry: 2hsm, 3 Å

PDB Description: Structural basis of yeast aminoacyl-tRNA synthetase complex formation revealed by crystal structures of two binary sub-complexes

PDB Compounds: (B:) GU4 nucleic-binding protein 1

SCOPe Domain Sequences for d2hsmb1:

Sequence; same for both SEQRES and ATOM records:

>d2hsmb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivstl
yptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklei

Timeline for d2hsmb1:

• d2hsmb1 first appeared in SCOP 1.75
  
• d2hsmb1 appears in SCOPe 2.02
  
• d2hsmb1 is called d2hsmb_ in SCOPe 2.04
  
• d2hsmb1 appears in the current release, SCOPe 2.08, called d2hsmb_