Lineage for d2hsjd_ (2hsj D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1588097Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 1588110Family c.23.10.3: Acetylhydrolase [52273] (3 proteins)
  6. 1588131Protein Uncharacterized protein SP1450 [159480] (1 species)
    Putative platelet activating factor
  7. 1588132Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [159481] (1 PDB entry)
    Uniprot Q97PY9 1-211
  8. 1588136Domain d2hsjd_: 2hsj D: [147392]
    automated match to d2hsja1
    complexed with gol, mg

Details for d2hsjd_

PDB Entry: 2hsj (more details), 1.5 Å

PDB Description: the structure of a putative platelet activating factor from streptococcus pneumonia.
PDB Compounds: (D:) Putative platelet activating factor

SCOPe Domain Sequences for d2hsjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hsjd_ c.23.10.3 (D:) Uncharacterized protein SP1450 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
snamavqllenwllkeqekiqtkyrhlnhisvvepnilfigdsiveyyplqelfgtskti
vnrgirgyqtglllenldahlyggavdkiflligtndigkdvpvnealnnleaiiqsvar
dyplteikllsilpvnereeyqqavyirsnekiqnwnqayqelasaymqvefvpvfdclt
dqagqlkkeyttdglhlsiagyqalskslkdyly

SCOPe Domain Coordinates for d2hsjd_:

Click to download the PDB-style file with coordinates for d2hsjd_.
(The format of our PDB-style files is described here.)

Timeline for d2hsjd_: