| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.10: SGNH hydrolase [52266] (10 families) ![]() |
| Family c.23.10.3: Acetylhydrolase [52273] (3 proteins) |
| Protein Uncharacterized protein SP1450 [159480] (1 species) Putative platelet activating factor |
| Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [159481] (1 PDB entry) Uniprot Q97PY9 1-211 |
| Domain d2hsjd_: 2hsj D: [147392] automated match to d2hsja1 complexed with gol, mg |
PDB Entry: 2hsj (more details), 1.5 Å
SCOPe Domain Sequences for d2hsjd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hsjd_ c.23.10.3 (D:) Uncharacterized protein SP1450 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
snamavqllenwllkeqekiqtkyrhlnhisvvepnilfigdsiveyyplqelfgtskti
vnrgirgyqtglllenldahlyggavdkiflligtndigkdvpvnealnnleaiiqsvar
dyplteikllsilpvnereeyqqavyirsnekiqnwnqayqelasaymqvefvpvfdclt
dqagqlkkeyttdglhlsiagyqalskslkdyly
Timeline for d2hsjd_: