SCOPe 2.01: Domain d2hsjd_: 2hsj D:

Lineage for d2hsjd_ (2hsj D:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.3: Acetylhydrolase [52273] (2 proteins)

6. Protein Uncharacterized protein SP1450 [159480] (1 species)
   Putative platelet activating factor

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [159481] (1 PDB entry)
   Uniprot Q97PY9 1-211

8. Domain d2hsjd_: 2hsj D: [147392]
   automated match to d2hsja1
   complexed with gol, mg

Details for d2hsjd_

PDB Entry: 2hsj, 1.5 Å

PDB Description: the structure of a putative platelet activating factor from streptococcus pneumonia.

PDB Compounds: (D:) Putative platelet activating factor

SCOPe Domain Sequences for d2hsjd_:

Sequence; same for both SEQRES and ATOM records:

>d2hsjd_ c.23.10.3 (D:) Uncharacterized protein SP1450 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
snamavqllenwllkeqekiqtkyrhlnhisvvepnilfigdsiveyyplqelfgtskti
vnrgirgyqtglllenldahlyggavdkiflligtndigkdvpvnealnnleaiiqsvar
dyplteikllsilpvnereeyqqavyirsnekiqnwnqayqelasaymqvefvpvfdclt
dqagqlkkeyttdglhlsiagyqalskslkdyly

Timeline for d2hsjd_:

• d2hsjd_ first appeared in SCOP 1.75, called d2hsjd1
  
• d2hsjd_ appears in SCOPe 2.02
  
• d2hsjd_ appears in the current release, SCOPe 2.08, called d2hsjd2