SCOP 1.75: Domain d2hsjd1: 2hsj D:1-211

Lineage for d2hsjd1 (2hsj D:1-211)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (9 families)

5. Family c.23.10.3: Acetylhydrolase [52273] (2 proteins)

6. Protein Uncharacterized protein SP1450 [159480] (1 species)
   Putative platelet activating factor

7. Species Streptococcus pneumoniae [TaxId:1313] [159481] (1 PDB entry)
   Uniprot Q97PY9 1-211

8. Domain d2hsjd1: 2hsj D:1-211 [147392]
   automatically matched to 2HSJ A:1-211
   complexed with gol, mg

Details for d2hsjd1

PDB Entry: 2hsj, 1.5 Å

PDB Description: the structure of a putative platelet activating factor from streptococcus pneumonia.

PDB Compounds: (D:) Putative platelet activating factor

SCOP Domain Sequences for d2hsjd1:

Sequence; same for both SEQRES and ATOM records:

>d2hsjd1 c.23.10.3 (D:1-211) Uncharacterized protein SP1450 {Streptococcus pneumoniae [TaxId: 1313]}
mavqllenwllkeqekiqtkyrhlnhisvvepnilfigdsiveyyplqelfgtsktivnr
girgyqtglllenldahlyggavdkiflligtndigkdvpvnealnnleaiiqsvardyp
lteikllsilpvnereeyqqavyirsnekiqnwnqayqelasaymqvefvpvfdcltdqa
gqlkkeyttdglhlsiagyqalskslkdyly

Timeline for d2hsjd1:

• d2hsjd1 is new in SCOP 1.75
  
• d2hsjd1 is called d2hsjd_ in SCOPe 2.01
  
• d2hsjd1 appears in the current release, SCOPe 2.08, called d2hsjd2