SCOPe 2.04: Domain d2hsjc_: 2hsj C:

Lineage for d2hsjc_ (2hsj C:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.3: Acetylhydrolase [52273] (3 proteins)

6. Protein Uncharacterized protein SP1450 [159480] (1 species)
   Putative platelet activating factor

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [159481] (1 PDB entry)
   Uniprot Q97PY9 1-211

8. Domain d2hsjc_: 2hsj C: [147391]
   automated match to d2hsja1
   complexed with gol, mg

Details for d2hsjc_

PDB Entry: 2hsj, 1.5 Å

PDB Description: the structure of a putative platelet activating factor from streptococcus pneumonia.

PDB Compounds: (C:) Putative platelet activating factor

SCOPe Domain Sequences for d2hsjc_:

Sequence; same for both SEQRES and ATOM records:

>d2hsjc_ c.23.10.3 (C:) Uncharacterized protein SP1450 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
amavqllenwllkeqekiqtkyrhlnhisvvepnilfigdsiveyyplqelfgtsktivn
rgirgyqtglllenldahlyggavdkiflligtndigkdvpvnealnnleaiiqsvardy
plteikllsilpvnereeyqqavyirsnekiqnwnqayqelasaymqvefvpvfdcltdq
agqlkkeyttdglhlsiagyqalskslkdyly

Timeline for d2hsjc_:

• d2hsjc_ first appeared in SCOP 1.75, called d2hsjc1
  
• d2hsjc_ appears in SCOPe 2.03
  
• d2hsjc_ appears in SCOPe 2.05
  
• d2hsjc_ appears in the current release, SCOPe 2.08, called d2hsjc2