![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.10: SGNH hydrolase [52266] (9 families) ![]() |
![]() | Family c.23.10.3: Acetylhydrolase [52273] (2 proteins) |
![]() | Protein Uncharacterized protein SP1450 [159480] (1 species) Putative platelet activating factor |
![]() | Species Streptococcus pneumoniae [TaxId:1313] [159481] (1 PDB entry) Uniprot Q97PY9 1-211 |
![]() | Domain d2hsjc1: 2hsj C:1-211 [147391] automatically matched to 2HSJ A:1-211 complexed with gol, mg |
PDB Entry: 2hsj (more details), 1.5 Å
SCOP Domain Sequences for d2hsjc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hsjc1 c.23.10.3 (C:1-211) Uncharacterized protein SP1450 {Streptococcus pneumoniae [TaxId: 1313]} mavqllenwllkeqekiqtkyrhlnhisvvepnilfigdsiveyyplqelfgtsktivnr girgyqtglllenldahlyggavdkiflligtndigkdvpvnealnnleaiiqsvardyp lteikllsilpvnereeyqqavyirsnekiqnwnqayqelasaymqvefvpvfdcltdqa gqlkkeyttdglhlsiagyqalskslkdyly
Timeline for d2hsjc1: