SCOPe 2.07: Domain d2hsjb2: 2hsj B:1-211

Lineage for d2hsjb2 (2hsj B:1-211)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.3: Acetylhydrolase [52273] (3 proteins)

6. Protein Uncharacterized protein SP1450 [159480] (1 species)
   Putative platelet activating factor

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [159481] (1 PDB entry)
   Uniprot Q97PY9 1-211

8. Domain d2hsjb2: 2hsj B:1-211 [147390]
   Other proteins in same PDB: d2hsjb3, d2hsjc3, d2hsjd3
   automated match to d2hsja1
   complexed with gol, mg

Details for d2hsjb2

PDB Entry: 2hsj, 1.5 Å

PDB Description: the structure of a putative platelet activating factor from streptococcus pneumonia.

PDB Compounds: (B:) Putative platelet activating factor

SCOPe Domain Sequences for d2hsjb2:

Sequence; same for both SEQRES and ATOM records:

>d2hsjb2 c.23.10.3 (B:1-211) Uncharacterized protein SP1450 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mavqllenwllkeqekiqtkyrhlnhisvvepnilfigdsiveyyplqelfgtsktivnr
girgyqtglllenldahlyggavdkiflligtndigkdvpvnealnnleaiiqsvardyp
lteikllsilpvnereeyqqavyirsnekiqnwnqayqelasaymqvefvpvfdcltdqa
gqlkkeyttdglhlsiagyqalskslkdyly

Timeline for d2hsjb2:

• d2hsjb2 first appeared in SCOP 1.75, called d2hsjb1
  
• d2hsjb2 appears in SCOPe 2.06
  
• d2hsjb2 appears in the current release, SCOPe 2.08