Lineage for d2hsja1 (2hsj A:1-211)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1839223Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 1839236Family c.23.10.3: Acetylhydrolase [52273] (3 proteins)
  6. 1839257Protein Uncharacterized protein SP1450 [159480] (1 species)
    Putative platelet activating factor
  7. 1839258Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [159481] (1 PDB entry)
    Uniprot Q97PY9 1-211
  8. 1839259Domain d2hsja1: 2hsj A:1-211 [147389]
    complexed with gol, mg

Details for d2hsja1

PDB Entry: 2hsj (more details), 1.5 Å

PDB Description: the structure of a putative platelet activating factor from streptococcus pneumonia.
PDB Compounds: (A:) Putative platelet activating factor

SCOPe Domain Sequences for d2hsja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hsja1 c.23.10.3 (A:1-211) Uncharacterized protein SP1450 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mavqllenwllkeqekiqtkyrhlnhisvvepnilfigdsiveyyplqelfgtsktivnr
girgyqtglllenldahlyggavdkiflligtndigkdvpvnealnnleaiiqsvardyp
lteikllsilpvnereeyqqavyirsnekiqnwnqayqelasaymqvefvpvfdcltdqa
gqlkkeyttdglhlsiagyqalskslkdyly

SCOPe Domain Coordinates for d2hsja1:

Click to download the PDB-style file with coordinates for d2hsja1.
(The format of our PDB-style files is described here.)

Timeline for d2hsja1: