Lineage for d2hsja1 (2hsj A:1-211)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 826290Superfamily c.23.10: SGNH hydrolase [52266] (9 families) (S)
  5. 826303Family c.23.10.3: Acetylhydrolase [52273] (2 proteins)
  6. 826324Protein Uncharacterized protein SP1450 [159480] (1 species)
    Putative platelet activating factor
  7. 826325Species Streptococcus pneumoniae [TaxId:1313] [159481] (1 PDB entry)
    Uniprot Q97PY9 1-211
  8. 826326Domain d2hsja1: 2hsj A:1-211 [147389]
    complexed with gol, mg

Details for d2hsja1

PDB Entry: 2hsj (more details), 1.5 Å

PDB Description: the structure of a putative platelet activating factor from streptococcus pneumonia.
PDB Compounds: (A:) Putative platelet activating factor

SCOP Domain Sequences for d2hsja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hsja1 c.23.10.3 (A:1-211) Uncharacterized protein SP1450 {Streptococcus pneumoniae [TaxId: 1313]}
mavqllenwllkeqekiqtkyrhlnhisvvepnilfigdsiveyyplqelfgtsktivnr
girgyqtglllenldahlyggavdkiflligtndigkdvpvnealnnleaiiqsvardyp
lteikllsilpvnereeyqqavyirsnekiqnwnqayqelasaymqvefvpvfdcltdqa
gqlkkeyttdglhlsiagyqalskslkdyly

SCOP Domain Coordinates for d2hsja1:

Click to download the PDB-style file with coordinates for d2hsja1.
(The format of our PDB-style files is described here.)

Timeline for d2hsja1: