Lineage for d2hsed2 (2hse D:101-153)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263404Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. 2263405Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 2263406Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)
  7. 2263407Species Escherichia coli [TaxId:562] [57828] (60 PDB entries)
    Uniprot P00478
  8. 2263488Domain d2hsed2: 2hse D:101-153 [147388]
    Other proteins in same PDB: d2hsea1, d2hsea2, d2hseb1, d2hsec1, d2hsec2, d2hsed1
    automated match to d1d09b2
    complexed with asp, pct, po4, zn

Details for d2hsed2

PDB Entry: 2hse (more details), 2.6 Å

PDB Description: structure of d236a e. coli aspartate transcarbamoylase in the presence of phosphonoacetamide and l-aspartate at 2.60 a resolution
PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2hsed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hsed2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOPe Domain Coordinates for d2hsed2:

Click to download the PDB-style file with coordinates for d2hsed2.
(The format of our PDB-style files is described here.)

Timeline for d2hsed2: