Lineage for d2hseb2 (2hse B:101-153)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965821Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1966286Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. 1966287Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 1966288Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)
  7. 1966289Species Escherichia coli [TaxId:562] [57828] (60 PDB entries)
    Uniprot P00478
  8. 1966369Domain d2hseb2: 2hse B:101-153 [147384]
    Other proteins in same PDB: d2hsea1, d2hsea2, d2hseb1, d2hsec1, d2hsec2, d2hsed1
    automated match to d1d09b2
    complexed with asp, pct, po4, zn

Details for d2hseb2

PDB Entry: 2hse (more details), 2.6 Å

PDB Description: Structure of D236A E. coli Aspartate Transcarbamoylase in the presence of phosphonoacetamide and l-Aspartate at 2.60 A resolution
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2hseb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hseb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOPe Domain Coordinates for d2hseb2:

Click to download the PDB-style file with coordinates for d2hseb2.
(The format of our PDB-style files is described here.)

Timeline for d2hseb2: