SCOPe 2.01: Domain d2hseb2: 2hse B:101-153

Lineage for d2hseb2 (2hse B:101-153)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family)

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (2 species)

7. Species Escherichia coli [TaxId:562] [57828] (46 PDB entries)
   Uniprot P00478

8. Domain d2hseb2: 2hse B:101-153 [147384]
   Other proteins in same PDB: d2hsea1, d2hsea2, d2hseb1, d2hsec1, d2hsec2, d2hsed1
   automatically matched to d1acmb2
   complexed with asp, pct, po4, zn

Details for d2hseb2

PDB Entry: 2hse, 2.6 Å

PDB Description: structure of d236a e. coli aspartate transcarbamoylase in the presence of phosphonoacetamide and l-aspartate at 2.60 a resolution

PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2hseb2:

Sequence; same for both SEQRES and ATOM records:

>d2hseb2 g.41.7.1 (B:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d2hseb2:

• d2hseb2 first appeared in SCOP 1.75
  
• d2hseb2 appears in SCOPe 2.02
  
• d2hseb2 appears in the current release, SCOPe 2.08