Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) automatically mapped to Pfam PF01948 |
Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein) |
Protein Aspartate carbamoyltransferase [54895] (3 species) |
Species Escherichia coli [TaxId:562] [54896] (59 PDB entries) Uniprot P00478 |
Domain d2hseb1: 2hse B:8-100 [147383] Other proteins in same PDB: d2hsea1, d2hsea2, d2hseb2, d2hsec1, d2hsec2, d2hsed2 automated match to d1d09b1 complexed with asp, pct, po4, zn |
PDB Entry: 2hse (more details), 2.6 Å
SCOPe Domain Sequences for d2hseb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hseb1 d.58.2.1 (B:8-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]} qveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls edqvdqlalyapqatvnridnyevvgksrpslp
Timeline for d2hseb1: