SCOPe 2.03: Domain d2hseb1: 2hse B:8-100

Lineage for d2hseb1 (2hse B:8-100)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families)
   automatically mapped to Pfam PF01948

5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)

6. Protein Aspartate carbamoyltransferase [54895] (3 species)

7. Species Escherichia coli [TaxId:562] [54896] (59 PDB entries)
   Uniprot P00478

8. Domain d2hseb1: 2hse B:8-100 [147383]
   Other proteins in same PDB: d2hsea1, d2hsea2, d2hseb2, d2hsec1, d2hsec2, d2hsed2
   automated match to d1d09b1
   complexed with asp, pct, po4, zn

Details for d2hseb1

PDB Entry: 2hse, 2.6 Å

PDB Description: structure of d236a e. coli aspartate transcarbamoylase in the presence of phosphonoacetamide and l-aspartate at 2.60 a resolution

PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2hseb1:

Sequence; same for both SEQRES and ATOM records:

>d2hseb1 d.58.2.1 (B:8-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
qveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
edqvdqlalyapqatvnridnyevvgksrpslp

Timeline for d2hseb1:

• d2hseb1 first appeared in SCOP 1.75
  
• d2hseb1 appears in SCOPe 2.02
  
• d2hseb1 appears in SCOPe 2.04
  
• d2hseb1 appears in the current release, SCOPe 2.08