SCOPe 2.08: Domain d2hs5a2: 2hs5 A:94-231

Lineage for d2hs5a2 (2hs5 A:94-231)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.78: GntR ligand-binding domain-like [48007] (1 superfamily)
   core: 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.78.1: GntR ligand-binding domain-like [48008] (1 family)

5. Family a.78.1.1: GntR ligand-binding domain-like [48009] (2 proteins)

6. Protein Putative transcriptional regulator RHA1_ro03477 [158665] (1 species)

7. Species Rhodococcus sp. RHA1 [TaxId:101510] [158666] (1 PDB entry)
   Uniprot Q0SB06 94-231

8. Domain d2hs5a2: 2hs5 A:94-231 [147380]
   Other proteins in same PDB: d2hs5a1
   complexed with act

Details for d2hs5a2

PDB Entry: 2hs5, 2.2 Å

PDB Description: Structural Genomics, the crystal structure of a putative transcriptional regulator GntR from Rhodococcus sp. RHA1

PDB Compounds: (A:) putative transcriptional regulator GntR

SCOPe Domain Sequences for d2hs5a2:

Sequence; same for both SEQRES and ATOM records:

>d2hs5a2 a.78.1.1 (A:94-231) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]}
aeditelyicrrvvecagvngfdpatgdlsrvaealdladeryavedwtgvgtadihfhs
alaslnnsnridelmrsvwnearlvfhvmddahrfhgpyltrnheiydalaagnteaagq
llktyledaeaqilgayr

Timeline for d2hs5a2:

• d2hs5a2 first appeared in SCOP 1.75
  
• d2hs5a2 appears in SCOPe 2.07