Lineage for d2hrma2 (2hrm A:2-137)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427417Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2427418Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2427488Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 2427492Species Escherichia coli [TaxId:562] [51286] (10 PDB entries)
    Uniprot P06968
  8. 2427495Domain d2hrma2: 2hrm A:2-137 [147378]
    Other proteins in same PDB: d2hrma3
    automated match to d1rn8a_
    complexed with edo, uc5

Details for d2hrma2

PDB Entry: 2hrm (more details), 1.7 Å

PDB Description: crystal structure of dutpase complexed with substrate analogue methylene-dutp
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d2hrma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrma2 b.85.4.1 (A:2-137) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihiad
pslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqmi
fvpvvqaefnlvedfd

SCOPe Domain Coordinates for d2hrma2:

Click to download the PDB-style file with coordinates for d2hrma2.
(The format of our PDB-style files is described here.)

Timeline for d2hrma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hrma3