Class b: All beta proteins [48724] (178 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species) |
Species Escherichia coli [TaxId:562] [51286] (10 PDB entries) Uniprot P06968 |
Domain d2hrma2: 2hrm A:2-137 [147378] Other proteins in same PDB: d2hrma3 automated match to d1rn8a_ complexed with edo, uc5 |
PDB Entry: 2hrm (more details), 1.7 Å
SCOPe Domain Sequences for d2hrma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hrma2 b.85.4.1 (A:2-137) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]} mkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihiad pslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqmi fvpvvqaefnlvedfd
Timeline for d2hrma2: