Lineage for d2hrma2 (2hrm A:2-137)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.85: beta-clip [51268] (7 superfamilies)
double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
Superfamily b.85.4: dUTPase-like [51283] (2 families) 
forms tight trimer through an additional beta-sheet in each subunit
subunit beta-sheets are orthogonally packed around the three-fold axis
Family b.85.4.1: dUTPase-like [51284] (5 proteins) Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species) 
Species Escherichia coli [TaxId:562] [51286] (10 PDB entries)
Uniprot P06968
Domain d2hrma2: 2hrm A:2-137 [147378]
Other proteins in same PDB: d2hrma3
automated match to d1rn8a_
complexed with edo, uc5
Details for d2hrma2
PDB Entry: 2hrm (more details), 1.7 Å
PDB Description: crystal structure of dutpase complexed with substrate analogue methylene-dutp
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolaseSCOPe Domain Sequences for d2hrma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hrma2 b.85.4.1 (A:2-137) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Escherichia coli [TaxId: 562]}
mkkidvkildprvgkefplptyatsgsagldlraclndavelapgdttlvptglaihiad
pslaammlprsglghkhgivlgnlvglidsdyqgqlmisvwnrgqdsftiqpgeriaqmi
fvpvvqaefnlvedfd
SCOPe Domain Coordinates for d2hrma2:
Click to download the PDB-style file with coordinates for d2hrma2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hrma2:
- d2hrma2 first appeared in SCOP 1.75, called d2hrma1
- d2hrma2 appears in SCOPe 2.07
View in 3D
