SCOPe 2.06: Domain d2hrkb_: 2hrk B:

Lineage for d2hrkb_ (2hrk B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.2: Arc1p N-terminal domain-like [158491] (1 protein)
   PfamB PB021108

6. Protein GU4 nucleic-binding protein 1, Arc1p [158492] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [158493] (4 PDB entries)
   Uniprot P46672 4-121

8. Domain d2hrkb_: 2hrk B: [147377]
   automated match to d2hqta1
   protein/RNA complex; complexed with cl

Details for d2hrkb_

PDB Entry: 2hrk, 2.05 Å

PDB Description: Structural basis of yeast aminoacyl-tRNA synthetase complex formation revealed by crystal structures of two binary sub-complexes

PDB Compounds: (B:) GU4 nucleic-binding protein 1

SCOPe Domain Sequences for d2hrkb_:

Sequence; same for both SEQRES and ATOM records:

>d2hrkb_ a.45.1.2 (B:) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivst
lyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklein
h

Timeline for d2hrkb_:

• d2hrkb_ first appeared in SCOP 1.75, called d2hrkb1
  
• d2hrkb_ appears in SCOPe 2.05
  
• d2hrkb_ appears in SCOPe 2.07
  
• d2hrkb_ appears in the current release, SCOPe 2.08