Lineage for d2hrja1 (2hrj A:8-120)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1262003Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1262038Superfamily a.11.2: Second domain of FERM [47031] (1 family) (S)
    automatically mapped to Pfam PF00373
  5. 1262039Family a.11.2.1: Second domain of FERM [47032] (9 proteins)
  6. 1262090Protein Talin [81716] (2 species)
  7. 1262091Species Chicken (Gallus gallus) [TaxId:9031] [81717] (5 PDB entries)
  8. 1262093Domain d2hrja1: 2hrj A:8-120 [147376]
    automatically matched to d1mixa1

Details for d2hrja1

PDB Entry: 2hrj (more details)

PDB Description: nmr solution structure of the f2 subdomain of talin
PDB Compounds: (A:) Talin-1

SCOPe Domain Sequences for d2hrja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrja1 a.11.2.1 (A:8-120) Talin {Chicken (Gallus gallus) [TaxId: 9031]}
kffysdqnvdsrdpvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkh
kpgflelkdflpkeyikqkgerkifmahkncgnmseieakvryvklarslkty

SCOPe Domain Coordinates for d2hrja1:

Click to download the PDB-style file with coordinates for d2hrja1.
(The format of our PDB-style files is described here.)

Timeline for d2hrja1: