Class a: All alpha proteins [46456] (290 folds) |
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.2: Second domain of FERM [47031] (2 families) automatically mapped to Pfam PF00373 |
Family a.11.2.1: Second domain of FERM [47032] (9 proteins) |
Protein Talin [81716] (2 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [81717] (5 PDB entries) |
Domain d2hrja_: 2hrj A: [147376] automated match to d2hrja1 |
PDB Entry: 2hrj (more details)
SCOPe Domain Sequences for d2hrja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hrja_ a.11.2.1 (A:) Talin {Chicken (Gallus gallus) [TaxId: 9031]} etlllrrkffysdqnvdsrdpvqlnllyvqarddilngshpvsfdkacefagyqcqiqfg phneqkhkpgflelkdflpkeyikqkgerkifmahkncgnmseieakvryvklarslkty g
Timeline for d2hrja_: