Lineage for d2hrja_ (2hrj A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697426Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2697469Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 2697470Family a.11.2.1: Second domain of FERM [47032] (9 proteins)
  6. 2697520Protein Talin [81716] (2 species)
  7. 2697521Species Chicken (Gallus gallus) [TaxId:9031] [81717] (5 PDB entries)
  8. 2697523Domain d2hrja_: 2hrj A: [147376]
    automated match to d2hrja1

Details for d2hrja_

PDB Entry: 2hrj (more details)

PDB Description: nmr solution structure of the f2 subdomain of talin
PDB Compounds: (A:) Talin-1

SCOPe Domain Sequences for d2hrja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hrja_ a.11.2.1 (A:) Talin {Chicken (Gallus gallus) [TaxId: 9031]}
etlllrrkffysdqnvdsrdpvqlnllyvqarddilngshpvsfdkacefagyqcqiqfg
phneqkhkpgflelkdflpkeyikqkgerkifmahkncgnmseieakvryvklarslkty
g

SCOPe Domain Coordinates for d2hrja_:

Click to download the PDB-style file with coordinates for d2hrja_.
(The format of our PDB-style files is described here.)

Timeline for d2hrja_: