Lineage for d2hr2f_ (2hr2 F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726932Family a.118.8.8: CT2138-like [158785] (1 protein)
    probable biological unit is a homohexamer
    automatically mapped to Pfam PF12968

    this is a repeat family; one repeat unit is 2hr2 A:93-136 found in domain
  6. 2726933Protein Hypothetical protein CT2138 [158786] (1 species)
  7. 2726934Species Chlorobium tepidum [TaxId:1097] [158787] (1 PDB entry)
    Uniprot Q8KAL8 2-157
  8. 2726940Domain d2hr2f_: 2hr2 F: [147374]
    automated match to d2hr2a1
    complexed with cl, gol

Details for d2hr2f_

PDB Entry: 2hr2 (more details), 2.54 Å

PDB Description: crystal structure of a tpr-like protein (ct2138) from chlorobium tepidum tls at 2.54 a resolution
PDB Compounds: (F:) hypothetical protein

SCOPe Domain Sequences for d2hr2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hr2f_ a.118.8.8 (F:) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}
mkplkevvgaylalsdaqrqlvageydeaaancrrameishtmppeeafdhagfdafcha
glaealaglrsfdealhsadkalhyfnrrgelnqdegklwisavysralaldglgrgaea
mpefkkvvemieerkgetpgkermmevaidriaqlg

SCOPe Domain Coordinates for d2hr2f_:

Click to download the PDB-style file with coordinates for d2hr2f_.
(The format of our PDB-style files is described here.)

Timeline for d2hr2f_: