| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (11 families) ![]() |
| Family a.118.8.8: CT2138-like [158785] (1 protein) probable biological unit is a homohexamer automatically mapped to Pfam PF12968 this is a repeat family; one repeat unit is 2hr2 A:93-136 found in domain |
| Protein Hypothetical protein CT2138 [158786] (1 species) |
| Species Chlorobium tepidum [TaxId:1097] [158787] (1 PDB entry) Uniprot Q8KAL8 2-157 |
| Domain d2hr2d_: 2hr2 D: [147372] automated match to d2hr2a1 complexed with cl, gol |
PDB Entry: 2hr2 (more details), 2.54 Å
SCOPe Domain Sequences for d2hr2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hr2d_ a.118.8.8 (D:) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}
mkplkevvgaylalsdaqrqlvageydeaaancrrameishtmppeeafdhagfdafcha
glaealaglrsfdealhsadkalhyfnrrgelnqdegklwisavysralaldglgrgaea
mpefkkvvemieerkgetpgkermmevaidriaqlga
Timeline for d2hr2d_: