Lineage for d2hr2b1 (2hr2 B:2-157)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775786Superfamily a.118.8: TPR-like [48452] (8 families) (S)
  5. 775962Family a.118.8.8: CT2138-like [158785] (1 protein)
    probable biological unit is a homohexamer
    this is a repeat family; one repeat unit is 2hr2 A:93-136 found in domain
  6. 775963Protein Hypothetical protein CT2138 [158786] (1 species)
  7. 775964Species Chlorobium tepidum [TaxId:1097] [158787] (1 PDB entry)
    Uniprot Q8KAL8 2-157
  8. 775966Domain d2hr2b1: 2hr2 B:2-157 [147370]
    automatically matched to 2HR2 A:2-157
    complexed with cl, gol

Details for d2hr2b1

PDB Entry: 2hr2 (more details), 2.54 Å

PDB Description: crystal structure of a tpr-like protein (ct2138) from chlorobium tepidum tls at 2.54 a resolution
PDB Compounds: (B:) hypothetical protein

SCOP Domain Sequences for d2hr2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hr2b1 a.118.8.8 (B:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}
kplkevvgaylalsdaqrqlvageydeaaancrrameishtmppeeafdhagfdafchag
laealaglrsfdealhsadkalhyfnrrgelnqdegklwisavysralaldglgrgaeam
pefkkvvemieerkgetpgkermmevaidriaqlga

SCOP Domain Coordinates for d2hr2b1:

Click to download the PDB-style file with coordinates for d2hr2b1.
(The format of our PDB-style files is described here.)

Timeline for d2hr2b1: