SCOPe 2.08: Domain d2hr2a1: 2hr2 A:2-157

Lineage for d2hr2a1 (2hr2 A:2-157)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (11 families)

5. Family a.118.8.8: CT2138-like [158785] (1 protein)
   probable biological unit is a homohexamer
   automatically mapped to Pfam PF12968
   this is a repeat family; one repeat unit is 2hr2 A:93-136 found in domain

6. Protein Hypothetical protein CT2138 [158786] (1 species)

7. Species Chlorobium tepidum [TaxId:1097] [158787] (1 PDB entry)
   Uniprot Q8KAL8 2-157

8. Domain d2hr2a1: 2hr2 A:2-157 [147369]
   complexed with cl, gol

Details for d2hr2a1

PDB Entry: 2hr2, 2.54 Å

PDB Description: crystal structure of a tpr-like protein (ct2138) from chlorobium tepidum tls at 2.54 a resolution

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2hr2a1:

Sequence; same for both SEQRES and ATOM records:

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}
kplkevvgaylalsdaqrqlvageydeaaancrrameishtmppeeafdhagfdafchag
laealaglrsfdealhsadkalhyfnrrgelnqdegklwisavysralaldglgrgaeam
pefkkvvemieerkgetpgkermmevaidriaqlga

Timeline for d2hr2a1:

• d2hr2a1 first appeared in SCOP 1.75
  
• d2hr2a1 appears in SCOPe 2.07