Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families) |
Family d.108.1.4: FemXAB nonribosomal peptidyltransferases [82749] (3 proteins) duplication: consists of two NAT-like domains swapped with the C-terminal strands |
Protein Hypothetical protein BT3689 [160642] (1 species) |
Species Bacteroides thetaiotaomicron [TaxId:818] [160643] (1 PDB entry) Uniprot Q8A1H2 1-134! Uniprot Q8A1H2 135-298 |
Domain d2hqyb2: 2hqy B:1-134 [147368] automatically matched to 2HQY A:1-134 complexed with coa |
PDB Entry: 2hqy (more details), 1.8 Å
SCOP Domain Sequences for d2hqyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hqyb2 d.108.1.4 (B:1-134) Hypothetical protein BT3689 {Bacteroides thetaiotaomicron [TaxId: 818]} mipfkditladrdtitaftmksdrrncdlsfsnlcswrflydtqfaviddflvfkfwage qlaymmpvgngdlkavlrkliedadkekhnfcmlgvcsnmradleailperfiftedray adyiylrsdlatlk
Timeline for d2hqyb2: