SCOP 1.75: Domain d2hqyb2: 2hqy B:1-134

Lineage for d2hqyb2 (2hqy B:1-134)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families)

5. Family d.108.1.4: FemXAB nonribosomal peptidyltransferases [82749] (3 proteins)
   duplication: consists of two NAT-like domains swapped with the C-terminal strands

6. Protein Hypothetical protein BT3689 [160642] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [160643] (1 PDB entry)
   Uniprot Q8A1H2 1-134! Uniprot Q8A1H2 135-298

8. Domain d2hqyb2: 2hqy B:1-134 [147368]
   automatically matched to 2HQY A:1-134
   complexed with coa

Details for d2hqyb2

PDB Entry: 2hqy, 1.8 Å

PDB Description: Crystal Structure of Conserved Protein of Unknown Function from Bacteroides thetaiotaomicron VPI-5482

PDB Compounds: (B:) conserved hypothetical protein

SCOP Domain Sequences for d2hqyb2:

Sequence; same for both SEQRES and ATOM records:

>d2hqyb2 d.108.1.4 (B:1-134) Hypothetical protein BT3689 {Bacteroides thetaiotaomicron [TaxId: 818]}
mipfkditladrdtitaftmksdrrncdlsfsnlcswrflydtqfaviddflvfkfwage
qlaymmpvgngdlkavlrkliedadkekhnfcmlgvcsnmradleailperfiftedray
adyiylrsdlatlk

Timeline for d2hqyb2:

• d2hqyb2 is new in SCOP 1.75
  
• d2hqyb2 appears in SCOPe 2.01
  
• d2hqyb2 appears in the current release, SCOPe 2.08