Lineage for d2hqtn1 (2hqt N:4-121)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 769705Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 769706Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 770258Family a.45.1.2: Arc1p N-terminal domain-like [158491] (1 protein)
    PfamB PB021108
  6. 770259Protein GU4 nucleic-binding protein 1, Arc1p [158492] (1 species)
  7. 770260Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [158493] (4 PDB entries)
    Uniprot P46672 4-121
  8. 770275Domain d2hqtn1: 2hqt N:4-121 [147354]
    automatically matched to 2HQT A:4-121
    complexed with so4

Details for d2hqtn1

PDB Entry: 2hqt (more details), 1.9 Å

PDB Description: crystal structures of the interacting domains from yeast glutamyl-trna synthetase and trna aminoacylation and nuclear export cofactor arc1p reveal a novel function for an old fold
PDB Compounds: (N:) GU4 nucleic-binding protein 1

SCOP Domain Sequences for d2hqtn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hqtn1 a.45.1.2 (N:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivstl
yptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklei

SCOP Domain Coordinates for d2hqtn1:

Click to download the PDB-style file with coordinates for d2hqtn1.
(The format of our PDB-style files is described here.)

Timeline for d2hqtn1: