Lineage for d2hqtn_ (2hqt N:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713769Family a.45.1.2: Arc1p N-terminal domain-like [158491] (1 protein)
    PfamB PB021108
  6. 2713770Protein GU4 nucleic-binding protein 1, Arc1p [158492] (1 species)
  7. 2713771Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [158493] (4 PDB entries)
    Uniprot P46672 4-121
  8. 2713787Domain d2hqtn_: 2hqt N: [147354]
    Other proteins in same PDB: d2hqtf3, d2hqtj3
    automated match to d2hqta1
    complexed with so4

Details for d2hqtn_

PDB Entry: 2hqt (more details), 1.9 Å

PDB Description: crystal structures of the interacting domains from yeast glutamyl-trna synthetase and trna aminoacylation and nuclear export cofactor arc1p reveal a novel function for an old fold
PDB Compounds: (N:) GU4 nucleic-binding protein 1

SCOPe Domain Sequences for d2hqtn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hqtn_ a.45.1.2 (N:) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivst
lyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklei

SCOPe Domain Coordinates for d2hqtn_:

Click to download the PDB-style file with coordinates for d2hqtn_.
(The format of our PDB-style files is described here.)

Timeline for d2hqtn_: