| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.2: Arc1p N-terminal domain-like [158491] (1 protein) PfamB PB021108 |
| Protein GU4 nucleic-binding protein 1, Arc1p [158492] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [158493] (4 PDB entries) Uniprot P46672 4-121 |
| Domain d2hqtg_: 2hqt G: [147347] Other proteins in same PDB: d2hqtf3, d2hqtj3 automated match to d2hqta1 complexed with so4 |
PDB Entry: 2hqt (more details), 1.9 Å
SCOPe Domain Sequences for d2hqtg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hqtg_ a.45.1.2 (G:) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivst
lyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklein
Timeline for d2hqtg_: