Lineage for d2hqhd1 (2hqh D:26-97)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 947330Superfamily b.34.10: Cap-Gly domain [74924] (1 family) (S)
  5. 947331Family b.34.10.1: Cap-Gly domain [74925] (10 proteins)
    Pfam PF01302
  6. 947355Protein Dynactin 1 [141234] (1 species)
  7. 947356Species Human (Homo sapiens) [TaxId:9606] [141235] (3 PDB entries)
    Uniprot Q14203 1-99! Uniprot Q14203 25-98
  8. 947360Domain d2hqhd1: 2hqh D:26-97 [147340]
    automatically matched to d1txqa1
    complexed with zn

Details for d2hqhd1

PDB Entry: 2hqh (more details), 1.8 Å

PDB Description: crystal structure of p150glued and clip-170
PDB Compounds: (D:) Dynactin-1

SCOPe Domain Sequences for d2hqhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hqhd1 b.34.10.1 (D:26-97) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]}
plrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvqgrkyftcdegh
gifvrqsqiqvf

SCOPe Domain Coordinates for d2hqhd1:

Click to download the PDB-style file with coordinates for d2hqhd1.
(The format of our PDB-style files is described here.)

Timeline for d2hqhd1: