Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.10: Cap-Gly domain [74924] (2 families) |
Family b.34.10.1: Cap-Gly domain [74925] (11 proteins) Pfam PF01302 |
Protein Dynactin 1 [141234] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141235] (9 PDB entries) Uniprot Q14203 1-99! Uniprot Q14203 25-98 |
Domain d2hqhb_: 2hqh B: [147338] automated match to d1txqa1 complexed with zn |
PDB Entry: 2hqh (more details), 1.8 Å
SCOPe Domain Sequences for d2hqhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hqhb_ b.34.10.1 (B:) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} plrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvqgrkyftcdegh gifvrqsqiqvf
Timeline for d2hqhb_: