SCOPe 2.01: Domain d2hqhb1: 2hqh B:26-97

Lineage for d2hqhb1 (2hqh B:26-97)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.10: Cap-Gly domain [74924] (1 family)

5. Family b.34.10.1: Cap-Gly domain [74925] (10 proteins)
   Pfam PF01302

6. Protein Dynactin 1 [141234] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141235] (3 PDB entries)
   Uniprot Q14203 1-99! Uniprot Q14203 25-98

8. Domain d2hqhb1: 2hqh B:26-97 [147338]
   automatically matched to d1txqa1
   complexed with zn

Details for d2hqhb1

PDB Entry: 2hqh, 1.8 Å

PDB Description: crystal structure of p150glued and clip-170

PDB Compounds: (B:) Dynactin-1

SCOPe Domain Sequences for d2hqhb1:

Sequence; same for both SEQRES and ATOM records:

>d2hqhb1 b.34.10.1 (B:26-97) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]}
plrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvqgrkyftcdegh
gifvrqsqiqvf

Timeline for d2hqhb1:

• d2hqhb1 first appeared in SCOP 1.75
  
• d2hqhb1 appears in SCOPe 2.02
  
• d2hqhb1 appears in the current release, SCOPe 2.08, called d2hqhb_