![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.10: Cap-Gly domain [74924] (1 family) ![]() |
![]() | Family b.34.10.1: Cap-Gly domain [74925] (10 proteins) Pfam PF01302 |
![]() | Protein Dynactin 1 [141234] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141235] (3 PDB entries) Uniprot Q14203 1-99! Uniprot Q14203 25-98 |
![]() | Domain d2hqhb1: 2hqh B:26-97 [147338] automatically matched to d1txqa1 complexed with zn |
PDB Entry: 2hqh (more details), 1.8 Å
SCOP Domain Sequences for d2hqhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hqhb1 b.34.10.1 (B:26-97) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} plrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvqgrkyftcdegh gifvrqsqiqvf
Timeline for d2hqhb1: