Lineage for d2hqha_ (2hqh A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394495Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 2394496Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 2394521Protein Dynactin 1 [141234] (1 species)
  7. 2394522Species Human (Homo sapiens) [TaxId:9606] [141235] (9 PDB entries)
    Uniprot Q14203 1-99! Uniprot Q14203 25-98
  8. 2394529Domain d2hqha_: 2hqh A: [147337]
    automated match to d1txqa1
    complexed with zn

Details for d2hqha_

PDB Entry: 2hqh (more details), 1.8 Å

PDB Description: crystal structure of p150glued and clip-170
PDB Compounds: (A:) Dynactin-1

SCOPe Domain Sequences for d2hqha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hqha_ b.34.10.1 (A:) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]}
plrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvqgrkyftcdegh
gifvrqsqiqvf

SCOPe Domain Coordinates for d2hqha_:

Click to download the PDB-style file with coordinates for d2hqha_.
(The format of our PDB-style files is described here.)

Timeline for d2hqha_: