Lineage for d2hq5b1 (2hq5 B:2-72)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692210Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2692295Protein Multidrug binding protein QacR [68964] (1 species)
  7. 2692296Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
    Uniprot P23217
  8. 2692312Domain d2hq5b1: 2hq5 B:2-72 [147331]
    Other proteins in same PDB: d2hq5a2, d2hq5b2, d2hq5d2, d2hq5e2
    automated match to d1rkwa1
    complexed with so4

Details for d2hq5b1

PDB Entry: 2hq5 (more details), 2.8 Å

PDB Description: crystal structure of multidrug binding protein qacr from staphylococcus aureus cocrystallized with compound db359
PDB Compounds: (B:) HTH-type transcriptional regulator qacR

SCOPe Domain Sequences for d2hq5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hq5b1 a.4.1.9 (B:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

SCOPe Domain Coordinates for d2hq5b1:

Click to download the PDB-style file with coordinates for d2hq5b1.
(The format of our PDB-style files is described here.)

Timeline for d2hq5b1: