SCOPe 2.01: Domain d2hq4b_: 2hq4 B:

Lineage for d2hq4b_ (2hq4 B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.342: PH1570-like [159901] (1 superfamily)
   duplication: two beta(4)-alpha structural repeats, related by pseudo twofold symmetry; two extra helices in the linker region; single 8-standed antiparallel beta-sheet, order: 12348765

4. Superfamily d.342.1: PH1570-like [159902] (1 family)

5. Family d.342.1.1: PH1570-like [159903] (2 proteins)
   Pfam PF09638

6. Protein automated matches [190690] (1 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [187821] (1 PDB entry)

8. Domain d2hq4b_: 2hq4 B: [147328]
   Other proteins in same PDB: d2hq4a1
   automated match to d2hq4a1

Details for d2hq4b_

PDB Entry: 2hq4, 1.99 Å

PDB Description: crystal structure of orf 1580 a hypothetical protein from pyrococcus horikoshii

PDB Compounds: (B:) Hypothetical protein PH1570

SCOPe Domain Sequences for d2hq4b_:

Sequence, based on SEQRES records:

>d2hq4b_ d.342.1.1 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
dlyfqggsgmqceeklevfengfkdekfnvevkfygndarkvllamiyelylpeygreyv
ypfecakefwniylegeeiqdeefqlkpikftseqvikklqeeikkikppleikieeaki
yktkegylavgnyfildprgrlfifnkpsiankilkyiwkw

Sequence, based on observed residues (ATOM records):

>d2hq4b_ d.342.1.1 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
dlyfqggsgmqceeklevfengfkdekfnvevkfygndarkvllamiyelylpeygreyv
ypfecakefwniylegeeiqdfqlkpikftseqvikklqeeikkikppleikieeakiyk
tkegylavgnyfildprgrlfifnkpsiankilkyiwkw

Timeline for d2hq4b_:

• d2hq4b_ first appeared in SCOP 1.75, called d2hq4b1
  
• d2hq4b_ appears in SCOPe 2.02
  
• d2hq4b_ appears in the current release, SCOPe 2.08, called d2hq4b2