SCOPe 2.07: Domain d2hq3a_: 2hq3 A:

Lineage for d2hq3a_ (2hq3 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.357: NosL/MerB-like [160386] (1 superfamily)
   unusual fold; comprises two structural repeats of beta(2)-alpha-beta motifs, forming separate beta-sheets; probable duplication

4. Superfamily d.357.1: NosL/MerB-like [160387] (2 families)

5. Family d.357.1.1: NosL-like [160388] (1 protein)
   Pfam PF05573

6. Protein NosL [160389] (1 species)

7. Species Achromobacter cycloclastes [TaxId:223] [160390] (2 PDB entries)
   Uniprot O68481 53-178

8. Domain d2hq3a_: 2hq3 A: [147326]
   automated match to d2hq3a1

Details for d2hq3a_

PDB Entry: 2hq3

PDB Description: solution nmr structure of the apo-nosl protein from achromobacter cycloclastes

PDB Compounds: (A:) NosL protein

SCOPe Domain Sequences for d2hq3a_:

Sequence; same for both SEQRES and ATOM records:

>d2hq3a_ d.357.1.1 (A:) NosL {Achromobacter cycloclastes [TaxId: 223]}
kaqiflegspaplffsqvrdaiayargpeqiapilviyvndmgaagatwdqpgdgnwiaa
dkafyvvgsarrggmgapeavpfssrdeaaafvlaeggqvlaladitdamvltpvetgse
pradde

Timeline for d2hq3a_:

• d2hq3a_ first appeared in SCOP 1.75, called d2hq3a1
  
• d2hq3a_ appears in SCOPe 2.06
  
• d2hq3a_ appears in the current release, SCOPe 2.08