Lineage for d2hq3a1 (2hq3 A:35-160)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1449522Fold d.357: NosL/MerB-like [160386] (1 superfamily)
    unusual fold; comprises two structural repeats of beta(2)-alpha-beta motifs, forming separate beta-sheets; probable duplication
  4. 1449523Superfamily d.357.1: NosL/MerB-like [160387] (2 families) (S)
  5. 1449524Family d.357.1.1: NosL-like [160388] (1 protein)
    Pfam PF05573
  6. 1449525Protein NosL [160389] (1 species)
  7. 1449526Species Achromobacter cycloclastes [TaxId:223] [160390] (2 PDB entries)
    Uniprot O68481 53-178
  8. 1449527Domain d2hq3a1: 2hq3 A:35-160 [147326]
    automatically matched to 2HPU A:35-160

Details for d2hq3a1

PDB Entry: 2hq3 (more details)

PDB Description: solution nmr structure of the apo-nosl protein from achromobacter cycloclastes
PDB Compounds: (A:) NosL protein

SCOPe Domain Sequences for d2hq3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hq3a1 d.357.1.1 (A:35-160) NosL {Achromobacter cycloclastes [TaxId: 223]}
kaqiflegspaplffsqvrdaiayargpeqiapilviyvndmgaagatwdqpgdgnwiaa
dkafyvvgsarrggmgapeavpfssrdeaaafvlaeggqvlaladitdamvltpvetgse
pradde

SCOPe Domain Coordinates for d2hq3a1:

Click to download the PDB-style file with coordinates for d2hq3a1.
(The format of our PDB-style files is described here.)

Timeline for d2hq3a1: