SCOP 1.75: Domain d2hq3a1: 2hq3 A:35-160

Lineage for d2hq3a1 (2hq3 A:35-160)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.357: NosL/MerB-like [160386] (1 superfamily)
   unusual fold; comprises two structural repeats of beta(2)-alpha-beta motifs, forming separate beta-sheets; probable duplication

4. Superfamily d.357.1: NosL/MerB-like [160387] (2 families)

5. Family d.357.1.1: NosL-like [160388] (1 protein)
   Pfam PF05573

6. Protein NosL [160389] (1 species)

7. Species Achromobacter cycloclastes [TaxId:223] [160390] (2 PDB entries)
   Uniprot O68481 53-178

8. Domain d2hq3a1: 2hq3 A:35-160 [147326]
   automatically matched to 2HPU A:35-160

Details for d2hq3a1

PDB Entry: 2hq3

PDB Description: solution nmr structure of the apo-nosl protein from achromobacter cycloclastes

PDB Compounds: (A:) NosL protein

SCOP Domain Sequences for d2hq3a1:

Sequence; same for both SEQRES and ATOM records:

>d2hq3a1 d.357.1.1 (A:35-160) NosL {Achromobacter cycloclastes [TaxId: 223]}
kaqiflegspaplffsqvrdaiayargpeqiapilviyvndmgaagatwdqpgdgnwiaa
dkafyvvgsarrggmgapeavpfssrdeaaafvlaeggqvlaladitdamvltpvetgse
pradde

Timeline for d2hq3a1:

• d2hq3a1 is new in SCOP 1.75
  
• d2hq3a1 appears in SCOPe 2.01
  
• d2hq3a1 appears in the current release, SCOPe 2.08, called d2hq3a_