![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily) core: alpha3-beta3-alpha4; one side of beta-sheet is exposed |
![]() | Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) ![]() |
![]() | Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins) |
![]() | Domain d2hoih2: 2hoi H:130-341 [147324] Other proteins in same PDB: d2hoia1, d2hoib1, d2hoig1, d2hoih1 automated match to d1f44a2 protein/DNA complex |
PDB Entry: 2hoi (more details), 2.6 Å
SCOPe Domain Sequences for d2hoih2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hoih2 d.163.1.1 (H:130-341) automated matches {Enterobacteria phage [TaxId: 10678]} rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd ggrmlihigrtatlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei mqaggwtnvnivmnyirnldsetgamvrlled
Timeline for d2hoih2: