![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (2 families) ![]() |
![]() | Domain d2hoih1: 2hoi H:20-129 [147323] Other proteins in same PDB: d2hoia2, d2hoib2, d2hoig2, d2hoih2 automated match to d1drga1 protein/DNA complex |
PDB Entry: 2hoi (more details), 2.6 Å
SCOPe Domain Sequences for d2hoih1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hoih1 a.60.9.0 (H:20-129) automated matches {Enterobacteria phage [TaxId: 10678]} sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage
Timeline for d2hoih1: